PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P08840_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 670aa    MW: 75297.9 Da    PI: 7.6333
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P08840_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.2e-194598356
                           --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           k++++t++q+e Le+ Fe ++++  e++ +LAk lgL+ rqV +WFqNrRa++k
  GSMUA_Achr7P08840_001 45 KKRRLTADQVEFLEKNFEVENKLEPERKLQLAKDLGLKPRQVAIWFQNRRARWK 98
                           56689************************************************9 PP

2HD-ZIP_I/II125.42.5e-4045135292
            HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                            kkrrl+++qv++LE++Fe e+kLeperK +la++Lgl+prqva+WFqnrRAR+k+kqlEk ye+Lk++yd+lk ++++L ke+e+L++
  GSMUA_Achr7P08840_001  45 KKRRLTADQVEFLEKNFEVENKLEPERKLQLAKDLGLKPRQVAIWFQNRRARWKAKQLEKGYESLKSSYDSLKLDHDNLLKENEKLQA 132
                            9**************************************************************************************9 PP

            HD-ZIP_I/II  90 elk 92 
                            e+ 
  GSMUA_Achr7P08840_001 133 EVV 135
                            875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-1935102IPR009057Homeodomain-like
PROSITE profilePS5007117.49140100IPR001356Homeobox domain
SMARTSM003891.5E-1742104IPR001356Homeobox domain
CDDcd000862.04E-1643101No hitNo description
PfamPF000461.1E-164598IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.0E-2047107IPR009057Homeodomain-like
PRINTSPR000315.1E-57180IPR000047Helix-turn-helix motif
PROSITE patternPS0002707598IPR017970Homeobox, conserved site
PRINTSPR000315.1E-58096IPR000047Helix-turn-helix motif
PfamPF021831.8E-15100141IPR003106Leucine zipper, homeobox-associated
PfamPF044316.6E-20258309IPR007524Pectate lyase, N-terminal
Gene3DG3DSA:2.160.20.107.9E-131323660IPR012334Pectin lyase fold
SuperFamilySSF511267.94E-100324660IPR011050Pectin lyase fold/virulence factor
PRINTSPR008079.1E-74346363IPR018082AmbAllergen
PRINTSPR008079.1E-74370395IPR018082AmbAllergen
SMARTSM006569.1E-103398595IPR002022Pectate lyase/Amb allergen
PRINTSPR008079.1E-74406422IPR018082AmbAllergen
PfamPF005445.1E-22407589IPR002022Pectate lyase/Amb allergen
PRINTSPR008079.1E-74470491IPR018082AmbAllergen
PRINTSPR008079.1E-74550569IPR018082AmbAllergen
PRINTSPR008079.1E-74572591IPR018082AmbAllergen
PRINTSPR008079.1E-74614638IPR018082AmbAllergen
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0030570Molecular Functionpectate lyase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 670 aa     Download sequence    Send to blast
MITVHSASGS QFMVNSDGSH GNSLKFGLEE TADDDLDEYP QRPGKKRRLT ADQVEFLEKN  60
FEVENKLEPE RKLQLAKDLG LKPRQVAIWF QNRRARWKAK QLEKGYESLK SSYDSLKLDH  120
DNLLKENEKL QAEVVLLTNK LLQEEKDSSS WESFQLRICP DKLQPGIDAQ VMLCKQEDFS  180
SANSAVLESE SPQHVDDGGY SNQSQVVGCC GFLRPESHSC SNEFQKKKTT IGFTMEYKPR  240
FFFFSLLFLA SAAFTSAHIA DYDEYWQKKA ALARSHANNA YNPNPESVTH HFNEAVMRDL  300
ASNSTRRGLR GKMRNEDGAC QATNPIDRCF RCQSNWVHHR KKLATCAKGF GRHATGGKNG  360
DFYVVTDSSD ADLVNPRNGT LRHAVIQDRP LWIVFAHDML IRLTEELIIN SNKTIDGRGA  420
NVQIAYGAGL TIQFVHNVIV HNIRIHDIKA GNGGMIRDSE EHYGLRTRSD GDGISIFGAS  480
NIWIDHVSMS NCMDGLIDAI EGSTAITISN SHFTQHNDVM LFGASDAFSG DAIMQITVAF  540
NHFGKGLVQR MPRCRWGFVH VVNNDYTHWM MYAVGGSQHP TILSQGNRFI APPTLFAKEV  600
TKREYSPEPV WKQWSWRSEG DLMANGAFFV ESGAPITKPY ADLIKAKPGS FVTRLTRFAG  660
SRPCIPNQPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1pxz_A2e-933246602343Major pollen allergen Jun a 1
1pxz_B2e-933246602343Major pollen allergen Jun a 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
192100RRARWKAKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408830.10.0PREDICTED: pectate lyase-like
SwissprotP409730.0PLY_LILLO; Pectate lyase
TrEMBLM0TFX20.0M0TFX2_MUSAM; Pectate lyase
STRINGGSMUA_Achr7P08840_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.15e-37homeobox 1